Keep my session open?
Ending In 
The session is expired
Votre session a expiré. Pour votre sécurité, nous vous avons déconnecté.
Voulez-vous vous connecter à nouveau?

Anti-H1FX Mouse Monoclonal Antibody

Fournisseur: Abnova
Mouse monoclonal antibody raised against a full-length recombinant H1FX.

Type: Primary
Antigen: H1FX
Clonality: Monoclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype:
Reactivity: Human



Veuillez vous identifier afin de voir vos prix contrat et la disponibilté.
  Se souvenir de moi sur cet appareil
 

COMMANDE

Développer tout / Réduire tout
Taille Cdt Numéro de catalogue VWR Quantité
Up to 5 Clones 1 ABNOH00008971-M
Générer des étiquettes code barres Format des étiquettes barre-code: 
Créer une page catalogue sous forme pdf

SPÉCIFICATIONS

Symbole antigène H1FX
Nom de l'antigène H1 histone family, member X
Réactivité Human
Conjugaison Unconjugated
Clonalité Monoclonal
Type d' Anticorps Primary
Hôte Mouse
Western Blot Yes
ELISA Yes
Antigen synonyms H1.10, H1X
Amino acid number 1 to 213
Gene ID 8971
Format Liquid
Cross Adsorption No
Immunogen H1FX (NP_006017.1, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKKDKGGKAKKTAAAGGKKVKKAAKPSVPKVPKGRK
Enter Details

Select the article for which you are looking for Certificate

Indiquez le numéro de lot. Ce champ est obligatoire. ( Si lot inconnu, mettre un "x" )

Enter Certificate Details

Select Product:

Enter the Lot number:

Choose from recent batch/lot numbers:

Ou
Review & Compare Alternatives
We found alternative products that can save you up to  per item-unit.  To compare product details, select up to 3 alternatives below and click Compare Selected. To add items to your basket, enter a quantity and click Add to Basket.

Original Product:

Description Numéro de catalogue Availability Unité Votre prix Prix par Quantité